SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CTI2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CTI2
Domain Number 1 Region: 60-182
Classification Level Classification E-value
Superfamily Histone-fold 9.6e-35
Family Nucleosome core histones 0.0000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CTI2
Sequence length 184
Comment (Kluyveromyces lactis)
Sequence
MEQSIRSIDGSRSLSNVGASLIDRESINQRALQLLQRNRRRRLLLNRSEDKARYIQPERS
ASSQQIHPPEHHISAHERITKARGTRYKPTDLALAEIRKYQRSTDLLISRMPFARLVKEV
TDQFTTESEPLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIR
GQFI
Download sequence
Identical sequences Q6CTI2
gnl|GLV|KLLA0C12529g XP_452757.1.35115 28985.Q6CTI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]