SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CV23 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CV23
Domain Number 1 Region: 120-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.15e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 
Weak hits

Sequence:  28985.Q6CV23
Domain Number - Region: 77-134
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0196
Family Gametocyte protein Pfg27 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CV23
Sequence length 330
Comment (Kluyveromyces lactis)
Sequence
MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV
TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD
VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL
KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVARKKPKKI
KEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD
FIAPKETDYKSSISKSTKSSLGDRKRQRTD
Download sequence
Identical sequences Q6CV23
28985.Q6CV23 XP_452216.1.35115 gnl|GLV|KLLA0C00506g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]