SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CVE0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CVE0
Domain Number 1 Region: 179-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000775
Family SPRY domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CVE0
Sequence length 542
Comment (Kluyveromyces lactis)
Sequence
MGLIVLQDGFPNDRPIQGFPSDPVVRVPDDTIPADDAFSLMFLISLSITFGLLLLVLILI
SIYLTFCGGNDGDDSDDEDEDGTSVSFKFFRKRNSLLLDSSFMTPGKFDDDESLKVREAK
ELPKMSSFEVELYERTKEFQKMSPPMVKPLGSFLNSQDKQVIKDRGIQSYFFLPSINDNV
DINGAFLPSFFVEDKLNVSFTKFNISSSAIMNYPLPMNKKDAVYFEVKVYKFKTCSNSIF
SIGLMTCPYPYFRIPGTAAYSIAYESTGKLRINNAFGADTLLPKLEEGDVVGFGYRYSSG
TIFITHNGKKMMDVTHKVGIDLFVGLGAMNAAYTRTYTKDGLFEDPDNVSFRQKWSELQA
FNNGESSSDYIDARNVISKDLLQVHDPKEDTVSSDNIELHVNLGQLGFVFIEANVKKYAF
GSVYGDIGIPPAYNGDDIKQDMLLQKGDELPPEYPDDAVDFFGDIHSPASTSEPPSATFS
AGLPMDNAADTPVSTADADADADADADEEEPLISVKKPAAQTHSKKNNKKKKKKKSNRNR
RG
Download sequence
Identical sequences Q6CVE0
gnl|GLV|KLLA0B12760g XP_452099.1.35115 28985.Q6CVE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]