SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CVJ5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CVJ5
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.73e-39
Family Calponin-homology domain, CH-domain 0.000043
Further Details:      
 
Domain Number 2 Region: 183-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000128
Family EB1 dimerisation domain-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CVJ5
Sequence length 276
Comment (Kluyveromyces lactis)
Sequence
MAGIGESRSELLSWLNDLLKLDYTKVEQCGTGAAYCQIMDSIYGDLPMNRVNFCAGSEYE
YFTNYKILQSCFTKHKIEKSVLVERLVKCRFQDNLEFLQWIKKFWTQHKDESEYDAEVRR
KGRAGPSNPSAVSGNKRPVSSSTASKPPIRHIRSNVIQNNIRKSSNEQLLSLQTELSETR
NQLSELEKECSQYKELNTAYLKERDFYFGKLRDIEIIAQSTQDLCDEGVYENDKELRPFL
NRIQQILYATEEQTEPFVEENVEQASTNPIIDEETF
Download sequence
Identical sequences Q6CVJ5
gnl|GLV|KLLA0B11550g 28985.Q6CVJ5 XP_452044.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]