SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CYD6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CYD6
Domain Number 1 Region: 264-300,327-375,422-526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-16
Family SPRY domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CYD6
Sequence length 872
Comment (Kluyveromyces lactis)
Sequence
MSNSKMDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSG
SVSFQSLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYARDDISNT
TDGDGDVDMRKSVMTEEDFLGSMLPDSEADEEDDEIDDDNDLEDDDDDEDGNDPEDDDDD
ELDDEDEDENDEQDSPDHPRRLNESTVQIEQSRGSTTGFENPIGTSDAENIENAEVDRSK
HKHKIVYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLR
VNPNWHALSSYGRASPIMNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSV
TSSQAGRNSHVLVGFKNWAKINDKLSTSEQDTTESGSAPSSENFNMLRNVLDGNRNVLNS
PSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNG
IFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV
DYDSGLNLVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTR
DRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCI
PNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYL
ELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEI
SPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAM
VTTLMENESYNPREKEPAYHKLVNIDEDLLKL
Download sequence
Identical sequences Q6CYD6
XP_451053.1.35115 28985.Q6CYD6 gnl|GLV|KLLA0A01221g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]