SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q9Y746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q9Y746
Domain Number 1 Region: 43-252,319-416
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.4e-74
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 430-599
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.57e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28985.Q9Y746
Sequence length 609
Comment (Kluyveromyces lactis)
Sequence
MLKLLSLMVPLASAAVIHRRDANISAIASEWNSTSNSSSSLSLNRPAVHYSPEEGWMNDP
NGLWYDAKEEDWHIYYQYYPDAPHWGLPLTWGHAVSKDLTVWDEQGVAFGPEFETAGAFS
GSMVIDYNNTSGFFNSSTDPRQRVVAIWTLDYSGSETQQLSYSHDGGYTFTEYSDNPVLD
IDSDAFRDPKVFWYQGEDSESEGNWVMTVAEADRFSVLIYSSPDLKNWTLESNFSREGYL
GYNYECPGLVKVPYVKNTTYASAPGSNITSSGPLHPNSTVSFSNSSSIAWNASSVPLNIT
LSNSTLVDETSQLEEVGYAWVMIVSFNPGSILGGSGTEYFIGDFNGTHFEPLDKQTRFLD
LGKDYYALQTFFNTPNEVDVLGIAWASNWQYANQVPTDPWRSSMSLVRNFTITEYNINSN
TTALVLNSQPVLDFTSLRKNGTSYTLENLTLNSSSHEVLEFEDPTGVFEFSLEYSVNFTG
IHNWVFTDLSLYFQGDKDSDEYLRLGYEANSKQFFLDRGHSNIPFVQENPFFTQRLSVSN
PPSSNSSTFDVYGIVDRNIIELYFNNGTVTSTNTFFFSTGNNIGSIIVKSGVDDVYEIES
LKVNQFYVD
Download sequence
Identical sequences Q9Y746
28985.Q9Y746 gnl|GLV|KLLA0A10417g XP_451456.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]