SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290315.Clim_0271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  290315.Clim_0271
Domain Number - Region: 110-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0914
Family Xylanase/endoglucanase 11/12 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290315.Clim_0271
Sequence length 307
Comment (Chlorobium limicola DSM 245)
Sequence
MSKKKNRIADHLFHRLLLLAGVIVRRLNRSHTIALARISGDIVYDLLKIRRTLVETNLSL
TFPEKSGEEVSHIARQVYRNLAENAVEVLRLPLIRTSEDASRLVDADVRYFLAKTRDRNK
GAVCVSAHFGNWELLAVSLGLLISPVTVVVKRLKNRDIDRQINLWRGIRGNTVVYKRQAL
REGLRTLRGGGIMSFLADQSDPKGGFFMDFLGRRTSVFLGPAYLALKTGVPLFVVMCRRS
GRGRYIAAFEEVDTAGLGSGKGDAEELTRRYTRVLERYILQYPEEWFWLHNRWKRVEEPP
SFDSGEE
Download sequence
Identical sequences B3EEY3
290315.Clim_0271 WP_012465247.1.84751 gi|189345816|ref|YP_001942345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]