SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290317.Cpha266_1209 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290317.Cpha266_1209
Domain Number 1 Region: 251-367
Classification Level Classification E-value
Superfamily OmpA-like 6.28e-33
Family OmpA-like 0.0011
Further Details:      
 
Domain Number 2 Region: 79-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000296
Family Glycosyl hydrolases family 16 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290317.Cpha266_1209
Sequence length 369
Comment (Chlorobium phaeobacteroides DSM 266)
Sequence
MKFVSRNFPILALMTLFMFGQLSSAFAKQTGSNKADIVWNRYDFVPGDKIIFEDNQETES
NGEFPSKWELVDKDNIEIATVNGNNVLYFIKCNMNSGGGLVPRMKNTGIDYLPDEFTVEF
DAYFENSNKPAYYLYLTDTKHQRKLEKTAPSKTPHNHRNIQFDRVMAKVYGGAANYYPGM
TATSKPPSMWRHFAISYNKGYVKVYIDDARVLTIPDLGYNPTGIGIGSHITGTKNKGYIK
NVRIAAGSVKLYNSLMAKGRIATTGIKFDTGNATLKPESNGVINEIVKMMNTYPVIRLRI
EGHTDSDGDTSANQILSEKRSAAVKAALIKRGIAAVRLSISSFGETKPVADNTTSEGKAN
NRRVEFVKL
Download sequence
Identical sequences A1BFR7
WP_011745068.1.8298 290317.Cpha266_1209 gi|119357024|ref|YP_911668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]