SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290317.Cpha266_1871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290317.Cpha266_1871
Domain Number 1 Region: 9-157
Classification Level Classification E-value
Superfamily Flavoproteins 5.59e-21
Family Flavodoxin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290317.Cpha266_1871
Sequence length 216
Comment (Chlorobium phaeobacteroides DSM 266)
Sequence
MTNSTVQPMRAIILYDSRTSGGSTDKLIDAIGNELAETGAYVEKAKCKATGDYSFLQDFD
VVIMGAPVYYLLVSSQLLGALIQSNLKKHLKRKKIALFLTCGSPEAMATLLYLPQLKIHL
VRNKILAEKIFSPQDVSSPDAIESFVDELDEAYKKDRKHRSASLSWSDEALELLEQIPSF
FRSRIKTAAEEYAEEMGYTMITIDILEEAKADTGGL
Download sequence
Identical sequences A1BHL0
WP_011745694.1.8298 gi|119357667|ref|YP_912311.1| 290317.Cpha266_1871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]