SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290338.CKO_01999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290338.CKO_01999
Domain Number 1 Region: 62-199
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.72e-48
Family Glutathione S-transferase (GST), C-terminal domain 0.000000567
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000293
Family Glutathione S-transferase (GST), N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290338.CKO_01999
Sequence length 199
Comment (Citrobacter koseri ATCC BAA-895)
Sequence
MIFGLKNIPVELNVLANDDDATPTRMIGKKMAPILQKDDSRYLPESMDIVHYVDNLDGKP
LLIGKQNPAIDEWLRKVNGYANRLLLPRFAKSAFDEFSTPSARKYFTEKKEAMIGDFGEN
LAHSSGLIKNISDDLRALDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGINWPTRVAD
YRDNMAKQTQINLLSSMAL
Download sequence
Identical sequences A8AI12
290338.CKO_01999 gi|157146242|ref|YP_001453561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]