SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290338.CKO_02944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290338.CKO_02944
Domain Number 1 Region: 22-336
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.83e-105
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000388
Further Details:      
 
Domain Number 2 Region: 338-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290338.CKO_02944
Sequence length 468
Comment (Citrobacter koseri ATCC BAA-895)
Sequence
MTLASRWPAVLQAVMQGQPCALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSVDLVHWQHESIALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRIAWQCLAVQNDDGSFTKQGPVLPLPEGYTGHVRDPKVWCHDGQWYMVLGAQDLQ
KQGKVLLFTSDDLHHWQPCGEIAGQGVNGLTDSGYMWECPDLFALDETHVLICCPQGLAR
EPHRYLNTYPSVWMSGAFDYETASFAHGELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTCAYGWIHQMTCPRELKYRDGRLWQTPARELEQLREAEHQWQGRASDAPEL
EATRLEFELSTSYVNADFAGALRLTVDDYGVRLERASLKNGEMLTRYWQGDVSHLRVLCD
SSSIEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRRCMIE
Download sequence
Identical sequences A8AKN7
290338.CKO_02944 WP_012133763.1.88595 gi|157147167|ref|YP_001454486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]