SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290338.CKO_04562 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290338.CKO_04562
Domain Number 1 Region: 10-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.96e-50
Family Ribonuclease PH domain 1-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 312-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 156-245
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.09e-30
Family Ribonuclease PH domain 2-like 0.00093
Further Details:      
 
Domain Number 4 Region: 461-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.65e-27
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 5 Region: 237-336
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.53e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0013
Further Details:      
 
Domain Number 6 Region: 619-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.49e-22
Family Cold shock DNA-binding domain-like 0.0000246
Further Details:      
 
Domain Number 7 Region: 565-633
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290338.CKO_04562
Sequence length 722
Comment (Citrobacter koseri ATCC BAA-895)
Sequence
MCRQKLRKGIILLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKK
AKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPVRPLFPEGFVN
EVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDE
LKESKLDLVVAGTEAAVLMVESEAELLSEDTMLGAVVFGHEQQQIVIQNINDLVKEAGKP
RWDWQQEAVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSETIAALVAEDETLD
ENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQ
ALVTATLGTARDAQVLDELMGERTDSFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKR
GVLAVMPEMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLV
KEGDNFVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGA
RLHILGVMEQAINAPRGDISQFAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTTIEI
EDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRIYNGKVTRIVDFGAFVAIGGGKEGLV
HISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEATEQSQPAAAPEAPAAEQ
GE
Download sequence
Identical sequences 290338.CKO_04562 gi|157148733|ref|YP_001456052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]