SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290339.ESA_00437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290339.ESA_00437
Domain Number 1 Region: 127-317
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 2.74e-59
Family Lambda integrase-like, catalytic core 0.0000000304
Further Details:      
 
Domain Number 2 Region: 25-121
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 1e-34
Family lambda integrase-like, N-terminal domain 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290339.ESA_00437
Sequence length 319
Comment (Enterobacter sakazakii ATCC BAA-894)
Sequence
MYQIPLPVRHNAATGSVREVAVEQDLARIEQFLDALWLERNLAENSLSAYRRDLSMVVEW
LHHRGLSLATVQSGDLQTLLAERVEGGYKATSTARMLSAVRRLFQHLYREKIRDDDPSAL
LASPKLPQRLPKDLSEAQVERLLQAPTVEEPIELRDKAMLEVLYATGLRVSELVGLTMSD
VSLRQGVVRVIGKGNKERLVPLGEEAVYWLEQYLTHGRPWLLNGQSLDILFPSNRARQMT
RQTFWHRIKHYAQLAGIDSEKLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIY
THVATERLRQLHQQHHPRA
Download sequence
Identical sequences A7MR77
gi|156932654|ref|YP_001436570.1| 290339.ESA_00437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]