SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290339.ESA_03351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  290339.ESA_03351
Domain Number - Region: 15-41
Classification Level Classification E-value
Superfamily CalX-like 0.0157
Family CalX-beta domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290339.ESA_03351
Sequence length 60
Comment (Enterobacter sakazakii ATCC BAA-894)
Sequence
MRSSALAQADKQKKISEADETFFITLSGVKAARLSTVIVNNGQQQSERAEQQAADQQATG
Download sequence
Identical sequences A7MII1
290339.ESA_03351 gi|156935492|ref|YP_001439407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]