SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290339.ESA_04071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290339.ESA_04071
Domain Number 1 Region: 51-165
Classification Level Classification E-value
Superfamily FimD N-terminal domain-like 1.01e-24
Family Usher N-domain 0.00067
Further Details:      
 
Weak hits

Sequence:  290339.ESA_04071
Domain Number - Region: 454-581
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00446
Family Legume lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290339.ESA_04071
Sequence length 820
Comment (Enterobacter sakazakii ATCC BAA-894)
Sequence
MRGSKVKWLASFVMSAIFCRTVTAGEYFDPGLLQNIDGKAALSDTSLLSQGYQPAGTYRV
HINVNEKPIMMSSVRFEPDKNKQLVACLSFKAYQKLGVDMSKVSSKAEDNELKNTCVPME
EQVPGAKSSFDFSKLQLDITLPQTVLRDESVQGVPEEEWDDGIPAIISNYQLSGQQYLKK
GEGTEDSTYANLTNGVNIGAWRYRNNSAISNSEGWQSITNYVETAIHTLKSELTVGDSST
PGDVFDSLLIRGVQLSSDDDMLPDQLNGFAPIIRGIAKSNARVTVRENGYVIYQRSVPPG
PFVISDLASVSDGGKLDVVVTEADGSETHNTLAYSSVPQLLRTGQMKYNLSAGRYMSGTS
SFEHKPDVIQAVISRGLPLNTTLYGGAQYHDRYRAFSLGLGMDMKSLGGIAADLTESKGR
RGNSQEADGKMIRLTYRNYIPDSDTQIQVDNRYYTGDYLSFSDWATAEDLFADTRRRREY
NLSINQSLDDTNSFYTTLSRSENMDNSVSRMWQIGWNGSLKTVSFSLAYSMSRSESEARW
DKQLALTLSIPLSETFPTTQPMVNYTATSGLERDLNNQLGINGKVGDSQDMHWNTQLSYA
AKHGESSTKSGSAGFDYQGNYGDLNVTYNADQNNYISWNASGSVVGHRHGVTFGRNSTGS
MALVSIPGVPDVPLEGGQDLHTDSRGYALATDLRSYHRNSLSVDTQKAGKDIDFASTSTQ
LVPTKDAVVLAEFTAIRGRKAVFTINYKGEVLPFGTRAHIEGMDNAYYVGDKGQVYLNAV
PDKGILTFKWGEDKSCSTPFEMPVNQTPALPIVLLTLNCQ
Download sequence
Identical sequences A7MQC5
290339.ESA_04071 WP_012126230.1.34712 WP_012126230.1.38143 WP_012126230.1.52367 WP_012126230.1.56053 WP_012126230.1.61601 WP_012126230.1.67391 WP_012126230.1.83282 WP_012126230.1.9447 gi|156936172|ref|YP_001440088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]