SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_1401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_1401
Domain Number 1 Region: 66-388
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.1e-99
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000557
Further Details:      
 
Domain Number 2 Region: 410-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-24
Family Glycosyl hydrolases family 32 C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_1401
Sequence length 557
Comment (Arthrobacter aurescens TC1)
Sequence
MLAPEEPASLPPPNLQDFSPMTYPNPHLSRRHMLAASAAVVVAFSAASCTASPTPVPTPS
GPAPTASDPWRPVAHLTAEKNWLNDPNGLVYHDGTYHAFYQYNPRGNSWGNMSWGHSTSK
DLIHWEQQPVAMEASPEEEIFSGCIVMDKNNASGLGSAKNPPMVALYTSAYGKNGALPQG
AQAQSVAFSLDNGTTWQKYQGNPVLNLAPTNNNFRDPKVTWYEPGRYWVMTTVVADAQVV
KMFKSTDLLRWEYLSDFSGVGAQGGLWEVPELIQMNVEDSTAKKWVMLLSINPGGIAGGS
GMQYFVGEFDGTRFTAEDAAAPDAPLDESQWLDHGADYYAANSISGAPGDKPVLLGWMGN
WDYAQDVPTTPWRGSMAIPRELTLVRGEKRFELRSAIAGAAREAMEHSGEVKSKNLTVGS
SPKDLGQDFKGRTQLIELEMDLTSAREAGVLLRQSSGSDSGLRISYNKEARTVRVDRSKA
GTSNFSEKFSPFHQVALPSPSSKVHLTILLDSSSVEVFAAGGRAVVSDTFFPDWDNTGAS
VFSMEGDTDFTVTSRTL
Download sequence
Identical sequences A1R4L3
WP_011774122.1.67142 290340.AAur_1401 gi|119962964|ref|YP_947175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]