SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_3119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_3119
Domain Number 1 Region: 17-345
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.98e-71
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 414-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000309
Family Glycosyl hydrolases family 32 C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_3119
Sequence length 465
Comment (Arthrobacter aurescens TC1)
Sequence
MTDLALFDSLLAASTHPDPAFPRFHPRPAQGWINDPNGISYINGRYHVFFQYNPDSARHS
QIQWGHVSSPDLVRWEEHSVALSPQAGGPDSAGCWTGVVTSDDGVPTAAYSGIKDHGGHS
QVVIARGSSDLVTWKQDGHVAASMPADPLVTAVRDPFIFRFNGARYAMQGAGLSDGRAAL
LLYTVEDMDSWQYQGIWLTTADPVAAQHTPAEIWECPQLVQVPSGEWVMMFSLWLSGDDH
EHANGVGHLIGSLTSDPATGLPVFMPSSGGKSDLGRDFYAPQIVQLSYGSADAAPGSAPA
ALLWGWANEGPGRDGRRGRTQEEIDDAGWSGVLTHPRVLSVVDGALAVSPAPEVEAYRGA
SVVTGAAGSVALPGFAEVLVRGDANSVSGAVELLLGSGTDAQVVYSGSLAAGEELRIFLD
ASLVEVYRAGSVATTLRAYPAPGEEWQLTLPAGTTADVWELTLPA
Download sequence
Identical sequences A1R9A7
gi|119961949|ref|YP_948819.1| 290340.AAur_3119 WP_011775750.1.67142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]