SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_3201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_3201
Domain Number 1 Region: 12-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-16
Family Legume lectins 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_3201
Sequence length 193
Comment (Arthrobacter aurescens TC1)
Sequence
MITDIPWNRGEWTNQPAAVVEQAGDLLVTAAESSDAWRVTSYGFIHDTEHALLAPLPQDS
AMEVEFTAAFSQQFDQAGIFVRISAEHWIKAGVEFADGAAQVGAVVTNRFSDWSLAPVPD
WNGERVRMRVSRSGDALTIRAASGSNELRLVRVVPLAPDLVTVAGPFTCAPTRAGLTVPF
HSWRAKPADSQLH
Download sequence
Identical sequences A1R9I6
AaR65 WP_011775826.1.67142 gi|119962150|ref|YP_948898.1| 290340.AAur_3201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]