SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290397.Adeh_2757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290397.Adeh_2757
Domain Number 1 Region: 57-211
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000923
Family Cytochrome c3-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290397.Adeh_2757
Sequence length 237
Comment (Anaeromyxobacter dehalogenans 2CP-C)
Sequence
MRHPVAHARHPNVPQINTLEQLLKATALVAAAIAVLILAWYLVRRPPLNRTTKVLLLFGL
GVMPIGVALTGNIAGFEYTLKRPFCGSCHVMLPYTEDAADPASTSLAAIHSRNHAFGEES
CYTCHADYQMFGAMTTKLNGLKHLYFYVTEYANTGPYGEGGPKIHMYKSFQNGMCTRCHS
TTAPRWLANEEHSGMIEEIRSGDAKCVDCHGGEKVHPRAFAHGGNGRGPAASIGKGE
Download sequence
Identical sequences Q2ILJ4
gi|86159179|ref|YP_465964.1| 290397.Adeh_2757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]