SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290398.Csal_1429 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290398.Csal_1429
Domain Number 1 Region: 41-167
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.27e-35
Family HSP20 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290398.Csal_1429
Sequence length 169
Comment (Chromohalobacter salexigens DSM 3043)
Sequence
MSDKKFKEAATSVQSTPAVSDDQVVRSRAMSPFGELDRMFDSLFARDWMLPHRWERLTGL
KSTMPRVDILDKDAEVILRAEIPGIEPQDVDVSVTDRTVTIKGESHRESRKEEGDYYRCE
ISQGSVMRTVDLPCDIDADKAEATFKNGILEVTLPKLKEAHRRKLHIKA
Download sequence
Identical sequences Q1QXM5
290398.Csal_1429 gi|92113554|ref|YP_573482.1| WP_011506729.1.10555 2005195082 2005195594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]