SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_0403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_0403
Domain Number 1 Region: 24-337
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.1e-84
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000877
Further Details:      
 
Domain Number 2 Region: 344-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.93e-20
Family Glycosyl hydrolases family 32 C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_0403
Sequence length 523
Comment (Arthrobacter FB24)
Sequence
MTEMTHPLATVPRNELVARAEADPLRPRFHFVSPAGWLNDPNGVAQWSGTYHLFYQYNPE
GAFHHRILWGHATSPDLVHWTDQPVALEPSGGPDADGCWSGVLVNDGGTPTLVYSGRHGG
SELPCVAVGSPDLVNWTKAPENPVIPAPPAGVDITAYRDHCVWREGTRWRQLVGSGIRGR
GGTAFLYESADLRRWDYIGPLVIGDASSGDPAATNWQGTMWECVDLFRAGDGILGDRALE
SQTPGTDVLVFSAWHDGDTRHPLYWTGSYAGDSYTPRELHRLDYGGRYFYAPQSFADESG
RRVMFGWLQEGRTDGAMVEAGWSGVMSLPRVASLDAHGGLAFAPVPEVELLRRDHVRTGP
RTVGTGEVLAGVSGNQLDLELDLELEPGSVFRLGVLGSGPGGPDGVPAGAEETVIEVGYT
VGSGGSEQSYVLLDRVNSSLDRTVDAEEKSGPVQLPGGKLHLRVLVDRSALEIFANGKPL
TARAYPTLGGENVRLSAAGTVRLLQLDAWRMEGVFGAPRPLFP
Download sequence
Identical sequences A0JRY4
WP_011690274.1.37281 gi|116668971|ref|YP_829904.1| 290399.Arth_0403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]