SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_0425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_0425
Domain Number 1 Region: 10-343
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.01e-101
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000416
Further Details:      
 
Domain Number 2 Region: 363-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-29
Family Glycosyl hydrolases family 32 C-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_0425
Sequence length 497
Comment (Arthrobacter FB24)
Sequence
MNTATPTLGAYRPAMHYACKDTWLNDPNGLVFHDGIYHLYYQNNPFGNVHSNMSWGHATS
TDLVNWDEQPVAIPCDETEEIFSGSIVVDQDNTAGFGLSGTTPLVAVYTSAYKAGSAHEG
MQAQSIAWSTDGGYTWTKYSGNPVLTRNSPEFRDPKVFRYDGPAGSYWVMAAVEAHDYAV
LLYRSGDLKNWEYLSTFGPANGTGGIWECPDLFELPVDGDAGNTRWVLTVNMNPGGPNGG
SAGQYFVGDFDGVTFTSETTVTDGMQDPERVVDYQWLDWGRDYYAAVSFSNVPGGRRLMI
GWMNNWQYANHIPTSPWRSPMSLVREVALASIDGEPRLVQQPVPACTEGSVSGPTQRLSL
NGGVTVDGGKAVQLIEATFTPGTASEFGLVVCGSGSGSSGTRISIRPGSGQLMLDRTNSG
DTGFHEAFPSISTAPLQADAGTYSLRIFVDHCSVEVFAQGGLVTLTELIFPDPVHTGITV
FSTGGTAEASLQLTDLA
Download sequence
Identical sequences A0JS06
WP_011690296.1.37281 290399.Arth_0425 gi|116668993|ref|YP_829926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]