SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_1969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_1969
Domain Number 1 Region: 742-1160
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.13e-39
Family Glycosyltransferase family 36 C-terminal domain 0.075
Further Details:      
 
Weak hits

Sequence:  290399.Arth_1969
Domain Number - Region: 329-360
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0106
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number - Region: 134-202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0266
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_1969
Sequence length 1188
Comment (Arthrobacter FB24)
Sequence
MGPESFGGQPSRGPGPSELGVGPQACAFGQKRRSIENTIRRRRQVPFPKCGSCPAPTCVR
VPARRSRADSRFVRNSFLMGVSPTQETVPTDTRQGGLHAAGLLTDGLAPCLTASLRPVFR
WRLSQPEDADPAAARQTGYEITVEDSAGTGIWRSGPVPSSRQSGVPYGGPELAEDADYSW
RVRVNDAAGNPGPWSEASVFSTGLSDSGWGAHWIHRAAGGRPPLDVLDGVLRVAGSPFLP
VPCGPVRQFILDARLRPVMGWAGLLLRSSGPGTGLLLELNTAGNVVLRRAPAAWEIPAPV
APDTEVLASAQLERDAVASQERLPGKDMVPGTWQHLTVTDDGDTISVTLDGVELLSVAEP
SPAGAKGLLALHQGPRSQAEYASIRVTAAGPTPDNAPISAMLILDHRFDAGPEEARASLS
HWARTTVHRQPDEWSLFRTTIRLTGGVARARLFAAASHHAQLAVNGRPCLSTTSFSYPGE
GYYDAADVTALLAARTPQDTAAPPGQATDPVRQQSTDVSLTALLHWYGPGQGRAASVPGL
LVRLSVDYTDGRREVFGSGPDWRAAEAPYRQAGYRNDEGDPVEHLDGQAAVAFDTRQDMA
LALSYGPHPVPAFPALHPRRTFLSETFVAPEAFLTATDGTLVADFGRIIPARPEVDFRAG
AAGRTVMIRAGYSLDSCGRVDSGKTASQNTDMSFPYTQAEGPQPFRSSVHLGFRYLEIPG
VEASDLSRVGAVVVHGRHPHEGSFNSSDPALNAVFRLLRDSALYGVQEQFVDTPTREKGQ
FLADAVNISYATMALFGEHAYTAQALREFGWSAARYWNAGEDRGRYNAVYPNGDGKRDIP
DFSLMMPEWAEEYHLRTGDLALVKELLPHLRNTADYALRYLATDGPTAGLVTELGGGSGP
YLHGIVDWPAPGRFGYDMECAAKTTVNAQAYSALMSTARLCGIAGQEDDAVRYAGHARAL
AETIRTRLRVDGVMVDGLHADGTPSTHASQHATSFPLSLGITDPAHAAADADRIAAQGMR
QGPMTVHRLVRALVAEGLTDAVIDLLTSSDQPGWARLLEQGASFTWEAWELEDGTDYSQS
HAWSASVVKEILESLLGVRVTVPGGSELLIEPPACRLEHAQGSLPLPNGDVAVAWRRTTA
GTYLECTVPAGVTAIVRLPDSTAPANGPATRDFRVHAGTWNFTPSCES
Download sequence
Identical sequences A0JWD1
290399.Arth_1969 WP_011691817.1.37281 gi|116670518|ref|YP_831451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]