SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_2610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_2610
Domain Number 1 Region: 12-71
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.88e-16
Family F1F0 ATP synthase subunit C 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_2610
Sequence length 72
Comment (Arthrobacter FB24)
Sequence
MEGSINGSLNLIGYGLSAIGGGIGVGLVFAAYINGVARQPEAQRVLQPIAFLGLALTEAL
AILGLVFAFVLS
Download sequence
Identical sequences A0A0D1A7H7 A0A0Q5P718 A0A0U3QER6 A0JY69
290399.Arth_2610 WP_011692451.1.18317 WP_011692451.1.37281 WP_011692451.1.48706 WP_011692451.1.54192 WP_011692451.1.88909 gi|116671156|ref|YP_832089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]