SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_3140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_3140
Domain Number 1 Region: 19-354
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.45e-74
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 424-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000135
Family Glycosyl hydrolases family 32 C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_3140
Sequence length 476
Comment (Arthrobacter FB24)
Sequence
MPSPDLAAVRFDDVAAHHPDPAFPRFHPRPAQGWINDPNGVSFINGRYHVFFQYNPDSAR
HHRIAWGHVSSADLVRWEEHPVALRPQRGGPDEYGCWTGVVTDDGGVPTAAYSGVRSDGG
HSEVVIARGSADLVYWEQTGHVAATMPADGQVTAVRDPFIFRFNGKRYAMQGAGLANGHA
ALLLYTVEDLTDWKYQGIWLTSENPVASKFTPAEIWECPQLVRVPESFAAAGDSADSFGD
SGTWLMMFSLWLSGDAHEHANGVGHLIGSLTEDPVTGLPVFTPRGGGKSDHGRDFYAPQV
VALEDRALLWGWANEGPGRDGRRGRSQDDIDAAGWAGVLTFPRELSVVDGALVVSPAPEI
DAYRGAHTASRAGGTVQLPPFAEALVTAGPGESGAGGGDTAVELLLVGDGTRQTVFSGTV
EPGEELRVFVDASLVEVYRSGSVATTLRAYPAAGEEWQLLLPAGATAEVWELGQPS
Download sequence
Identical sequences A0JZP8
WP_011692969.1.37281 gi|116671685|ref|YP_832618.1| 290399.Arth_3140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]