SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290400.Jann_3135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290400.Jann_3135
Domain Number 1 Region: 33-152
Classification Level Classification E-value
Superfamily EF-hand 2.47e-18
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290400.Jann_3135
Sequence length 164
Comment (Jannaschia CCS1)
Sequence
MTLLKAGALALMIPVAFAAPTFAQDEGRDGPPRMIFSELDADGSGAVTLEELRAAGANRF
ANADADGDGALSRDELLAQGQERIEARVDRLLERADADGDGQLTQAEMEEAREGRRGFGR
RGPNPERIFERMDADSDGSVTQAEFDEAVATFLERMGRRHGDRR
Download sequence
Identical sequences Q28ML0
gi|89055626|ref|YP_511077.1| 290400.Jann_3135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]