SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290402.Cbei_0668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290402.Cbei_0668
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290402.Cbei_0668
Sequence length 90
Comment (Clostridium beijerinckii NCIMB 8052)
Sequence
MEISIPKDFVVDEVANFRVKVNKLIDEGQKNFIFNFNDCNFIDSTGLGALVAVYKKCAEK
NGSIKLKGLKPEVEKLFKLTRLDKVFEICP
Download sequence
Identical sequences A0A0B5QGL2 A0A0K2MJ33 A6LR75
gi|150015557|ref|YP_001307811.1| 290402.Cbei_0668 WP_011968016.1.13860 WP_011968016.1.15846 WP_011968016.1.16915 WP_011968016.1.35420 WP_011968016.1.41106 WP_011968016.1.44456 WP_011968016.1.46861 WP_011968016.1.48361 WP_011968016.1.51202 WP_011968016.1.65774 WP_011968016.1.69068 WP_011968016.1.88565 WP_011968016.1.91641 WP_011968016.1.95078 WP_011968016.1.96201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]