SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290402.Cbei_5010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290402.Cbei_5010
Domain Number 1 Region: 24-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 5.71e-94
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 334-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-25
Family Glycosyl hydrolases family 32 C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290402.Cbei_5010
Sequence length 485
Comment (Clostridium beijerinckii NCIMB 8052)
Sequence
MPNPKSYQEINQNLNNYYSNKEMSIWRNNFHIEMPFGLINDPNGLSYYDNKFHIFYQWNP
FGCEHKTKHWGLVTTTNFINFTKPQMALKPQDWFDRNGCYSGCGLVKDNELKLYYTGNVK
GPNGERESYQCLAIYRKDGIIEKHGVIIDKQPNGYTAHFRDPYVFIEDDTYYMILGVQSE
DLKGRALIYESIDSVKWNLLGELKTDMKDFGYMWECPNIIRISKGKHAFIFSPQGLEKEE
LKNQNLYQSGYVIGELDIESVELKNHSRFKELDMGFDFYAPQIFKHNGENIMIGWIGMPD
RDSEYPTYEHGWMYSLTMPRVLEYKNNVLYQKPINEMRNLRENELINIKGLILNNYNLAL
ESRSVEIMISIEVEDIESTEVKFKFNDEYILITYDNKRQLCTVDRSNMNIGGKGIRKFKL
NSSKELKMNVFIDNSVMEIYYQDGLEVTTLTYYPKSEGLELQIRNDSKITINELNMWNLR
SVKYE
Download sequence
Identical sequences A6M3D6 Q9ZHJ7
290402.Cbei_5010 gi|150019818|ref|YP_001312072.1| WP_012061159.1.44456 WP_012061159.1.51202 WP_012061159.1.88565 WP_012061159.1.91641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]