SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290434.BG0516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290434.BG0516
Domain Number 1 Region: 304-462
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.97e-28
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 188-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.59e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290434.BG0516
Sequence length 510
Comment (Borrelia garinii PBi)
Sequence
MIYIIFSSIFAGFILGFLVRVFLGRLSLLDLEKNLTKVRVESQLEIENERKQIIANAKSQ
MLKEKNQQDRDIRDRKNEIVNLEKRLLQREETLDKRISALDKQQSRVDFKIKEFEQKEKA
IREKEADLVKRLENISGLTREDARKIVIEKVEHESRRDAQVIINKSEQEAQLLADKVAKD
ILVSTMQRIVTEVSSEFTVASVELPNDEMKGRIIGKEGRNIRALETLIGADIIIDDTPEA
VVISCFDPIRKELAKRTLERLVTDGRIHPARIEEVVYNVTNEINSIIQEEGEKVVFDLNI
HGLDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEILAKEMKLDPIVVKRACLLHDIGK
GMESISENSEGHAITGAELAQSCGESEIVVNAIAAHHNEVKPESLEAIVVQIADAISASR
PGARRESLNNYINRLKRLEDIAYSFEGVQKCYAIQAGREVRIIVDNVLVNDEKSILLARD
IAKKIEAEMRYPGKIKVTIIRETRVIEYAR
Download sequence
Identical sequences Q661B6
WP_011193817.1.42220 WP_011193817.1.71747 WP_011193817.1.82866 gi|408671120|ref|YP_006871191.1| gi|51598759|ref|YP_072947.1| 290434.BG0516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]