SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290434.BG0831 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290434.BG0831
Domain Number 1 Region: 286-482
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-47
Family Ribonuclease PH domain 1-like 0.0000228
Further Details:      
 
Domain Number 2 Region: 2-136
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-43
Family Ribonuclease PH domain 1-like 0.0000447
Further Details:      
 
Domain Number 3 Region: 137-221
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.18e-27
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 444-539
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.19e-25
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 549-634
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.04e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 6 Region: 612-653,682-708
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000045
Family Cold shock DNA-binding domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290434.BG0831
Sequence length 715
Comment (Borrelia garinii PBi)
Sequence
MKIGRDELVFETGFMAKQANGSVLATYGGSSVLATVCCSNNVREDLDFVPLSVEYNEKYY
AAGKIPGGFIKREGKPKDKEILVSRLIDRPMRPLFDKRFGREIQVIPTTLATDQLNPPDI
VGMNAAFTAVFLSDIPFNGPIAAVRMVYLNGKFIVNPSFEEIHDSDLDIVVAGSLNGITM
VEGGANEVSEDILLSAIDGAHEYIKQICNAQKEFLDIVGEKEKLPLAFEEKIFEFKEELK
DFIYTDLKEACFVKGKLNRDKAITLLRNKSYEHFSSLEKLTDSNESLFYKAFDDFEREIV
RNSILNDKIRTDGRTPNEIRDIIAEVDILSRTHGSALFTRGETQALAVTTLGTSIDEQIM
DDIDGDKRLNFMLHYNFPPFSVGETGRLMTGRREIGHGHLAQRALESMVPGKNDFPYTIR
VVSEILESNGSSSMATVCAGSMSLMSAGVPVKRQVAGIAMGLISEGDKYVVLSDILGEED
HLGDMDFKVAGTKNGITGFQMDIKIENVTKHLMRDALEQARIGRMHILSVMDTVISDSRV
GISKYAPKIVQLQIDIDKISLVIGSTGKTVKAITDEFEVKVQIEQNGKIILFGDDDFKMQ
KAKERIESIVREPKVGEIYEGIVKKINSFGAFIELTPTKEGFLSTRLKSRDNKYGSGRFG
TGNRYPRFGGGDNIRGNVGLVRPPKLEEGQQIKVKIIDIDKFGKIDLEVVRDKDY
Download sequence
Identical sequences 290434.BG0831 gi|51599057|ref|YP_073245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]