SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290512.Paes_0506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290512.Paes_0506
Domain Number 1 Region: 310-507
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-49
Family Ribonuclease PH domain 1-like 0.0000203
Further Details:      
 
Domain Number 2 Region: 13-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-44
Family Ribonuclease PH domain 1-like 0.0000514
Further Details:      
 
Domain Number 3 Region: 470-567
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.01e-27
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 4 Region: 147-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-25
Family Ribonuclease PH domain 2-like 0.0027
Further Details:      
 
Domain Number 5 Region: 574-659
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.21e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 639-722
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-16
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290512.Paes_0506
Sequence length 734
Comment (Prosthecochloris aestuarii DSM 271)
Sequence
MSMFIRKEIDLGSGKTLSIETGKMAKQADGSAIVRLNDTMVLATVVSSKTPPSPNQSFFP
LQVEYREKYSAAGKFPGGFFKREGRPSEKEILSARLIDRALRPLFPDGYYQDTQIIISVI
SSDQINDADVLGGVAASAAIMVSDIPFQNSMSEVRVGRVNGEYIVNPNINELRDSDIDIS
IGGTENTICMLEGEMDEISEAEMLEAIRFGHEAIKKICALQNEIAAEVGKTARTFSAAKA
PDNLRQSIAEICSNELKELAYMPLCKEERAEKTAEIYKNAKAQTLQRYQQEITPEVIAAE
PEKALYLNEQIIGDAIHSIEKQVMREMILDDAKRLDGRRLDEVRPISIELGLIPRAHGSA
LFTRGETQALVTLTLGTKKDAQMIDTLTDDADKRFMLHYNFPPFSVGETGRVGGTSRREI
GHGNLAERAIRKVAPAESAFPYTIRIVSDILESNGSSSMASVCGGALAAMDGGVPLRKPV
SGIAMGLIKEGDRYAVLSDILGNEDHLGDMDFKVAGTADGITACQMDIKIDGLDYHILEQ
ALEQALHGRLHILDKMNEAIQEPRTEIGKYAPKLTTIQIPVDAIGMVIGKGGETIRSITE
ETGAEINIEDDGTVTIASASGEGASAALETIKLLISKPEVGTVYSGKVRDIREDLGAFVE
FLPKTDGLVHISEISNERVAKVSDHLKPGDKVKVKLVDVRKDPRTGKTRFALSIKALAEK
SADNGASDKAEANR
Download sequence
Identical sequences B4S5G5
290512.Paes_0506 gi|194333349|ref|YP_002015209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]