SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290633.GOX2008 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290633.GOX2008
Domain Number 1 Region: 161-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.01e-35
Family Tandem AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 2 Region: 31-91
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000596
Family Eukaryotic type KH-domain (KH-domain type I) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290633.GOX2008
Sequence length 393
Comment (Gluconobacter oxydans 621H)
Sequence
MLTTHPTRPVATSSGSEGNRTVALRFNDNILLQRLLGDHDRHLVRLEEGFDVKLSCRGNK
IAISGETESVGRAQAAIIALYNQLEQGGTIDASQVDGVIRLTALPSRPERLVDTRQGRPV
PEERPRGHNGHRRPEKGHGKPHNAPATAFGDLPAIKTKRGVIAPRSHGQAAYMEMLANTD
MVFGIGPAGTGKTYLAVAQAVGMLLAGQVDRIILSRPAVEAGERLGFLPGDMREKIDPYL
RPLYDALHDMMPGDQVVRRMGTGEIEVAPLAFMRGRTLAHSYVILDEAQNTTAAQMKMFL
TRMGEGTRMAITGDLSQIDLPNGVSSGLREAVETLEGIKGIGITRFSSEDVVRHPLVARI
VDAYEQKAPAPRDVFRNRLRRENNGTSKSTRRY
Download sequence
Identical sequences Q5FPF2
gi|58040436|ref|YP_192400.1| 290633.GOX2008 WP_011253521.1.3606 WP_011253521.1.61435 WP_011253521.1.92951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]