SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 291112.PAU_03645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  291112.PAU_03645
Domain Number - Region: 3-55
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0156
Family Calponin-homology domain, CH-domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 291112.PAU_03645
Sequence length 58
Comment (Photorhabdus asymbiotica)
Sequence
MYFCLFIRIKYYLFVAINIVKKNFMLILATIMIIYSYLDCAKRPAKMKSQNNIWEAIT
Download sequence
Identical sequences C7BL58
gi|253991119|ref|YP_003042475.1| 291112.PAU_03645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]