SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 291112.PAU_04025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  291112.PAU_04025
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-49
Family Ribonuclease PH domain 1-like 0.000015
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-47
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.23e-30
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.19e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 608-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.17e-23
Family Cold shock DNA-binding domain-like 0.0000296
Further Details:      
 
Domain Number 6 Region: 239-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.37e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0021
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.59e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 291112.PAU_04025
Sequence length 708
Comment (Photorhabdus asymbiotica)
Sequence
MLSPIVRKFQYGQHTIAIETGMMARQATAAVMVNMDDTAVFVTVVGQKKVKAGQDFFPLT
VNYQERTYAAGRVPGSFFRREGRPGEGETLVARLIDRPLRPLFPEGFLNEVQIVATVVSV
NPQVNPDIVAMIGASAALALSGIPFNGPIGAARVGYINDQYVLNPTSDELKNSRLDLVVS
GTAGAVLMVESEADLLTEEQMLGAVVFGHDQQQVVIDNINALVAEAGKEKWDWAPEPINQ
ELHDRVAALAESRLGDAYRITEKQERYAQVDVIKDEVIAALLEQDEALDEAEIHEILGNL
EKNVVRSRVLRGEPRIDGREKDMVRALDVRTGVLPRTHGSALFTRGETQALVTATLGTER
DAQIIDELMGERTDRFLLHYNFPPYSVGETGMIGSPKRREIGHGRLAKRGVLAVMPKANE
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNFVVLSD
ILGDEDHLGDMDFKVAGSREGVSALQMDIKIEGITREIMQVALNQAKGARLHILSVMEQA
INCPRNDISEFAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKHAISRIEEITAEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVADYLQVGQEVSVKVLEVDRQGRVRLSIKEAIVGTTVEEVQAPQSAE
Download sequence
Identical sequences B6VLG8
gi|253991498|ref|YP_003042854.1| WP_015836101.1.101450 291112.PAU_04025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]