SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 291272.BPEN_112 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  291272.BPEN_112
Domain Number 1 Region: 304-470
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-48
Family Ribonuclease PH domain 1-like 0.0000279
Further Details:      
 
Domain Number 2 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-47
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 3 Region: 452-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.05e-25
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 145-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.62e-25
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 611-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-20
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 6 Region: 226-327
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.66e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.003
Further Details:      
 
Domain Number 7 Region: 557-624
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 291272.BPEN_112
Sequence length 699
Comment (Candidatus Blochmannia pennsylvanicus BPEN)
Sequence
MLDPIIHKFKYGQHTVILDIGTIARQANAAVMVSMSDTTVLVTVVSSNQVRLEQDFFPLV
VNYQERTYAAGKFPGGFFRREGRPSENETLTSRLIDRPIRPLFPKGFINDVQVVATVVSV
NPQVNPDIVAIIGVSAALSLSDIPFFGPIGAARVGYIKNQYVLNPTTTELSNSKLDLVIS
GTESNILMVESESCLLSEKEILDAIIFGHEQQQIVIHNINKLVKKVGKTKYSWNEKEVNI
SLKTYLSELYESRAQDIYCFFDKKERHAQVDSIKKDIVKTVLNSYQHAAVDEKEIMYLLN
YLEAQSIRYRILTNKLRIDGRSQDTIRKIDIKTGILPRTHGSALFTRGDTQALVAVTLGT
ERDAQNIDGLTGIRVDRFLLHYNFPPYCVGEIGVIGAPKRREIGHGRLAKRGMLAVMPNA
NEFPYTIRVVSEITESNGSSSMASICGTSLALMDAGVPIKAAVAGVAMGLIKEGNDFVVL
SDIVSDEDHIGDMDFKVSGSRQGITALQMDIKTDGITYDIINIALKKAKNARLQILDVME
QIIKFPNQEISKFAPRIYSIKVNPDKIKDVIGKGGSVIRSLTEETNTIIDIEDNGIIKIV
ALDYDKAKQAIRRINDITANVEIGAVYTGKVSHIVEFGAFVTILSGKEGLVHISQISERR
INKVTDYLKLGQKVLVKVLEIDRQGRIRLSMKGVHQVSA
Download sequence
Identical sequences Q493T3
WP_011282659.1.26442 291272.BPEN_112 gi|71891895|ref|YP_277625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]