SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 291331.XOO0200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  291331.XOO0200
Domain Number - Region: 10-47
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0126
Family Zn-finger domain of Sec23/24 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 291331.XOO0200
Sequence length 145
Comment (Xanthomonas oryzae KACC10331)
Sequence
MEISRWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLL
GMYLLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLG
GERNGGKAGRGSENKRPFRDRRGDH
Download sequence
Identical sequences Q5H6G6
gi|58579823|ref|YP_198839.1| 291331.XOO0200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]