SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 291331.XOO3214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  291331.XOO3214
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-48
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 305-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.15e-47
Family Ribonuclease PH domain 1-like 0.0000114
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.96e-29
Family Ribonuclease PH domain 2-like 0.0000959
Further Details:      
 
Domain Number 4 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.45e-28
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 609-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-22
Family Cold shock DNA-binding domain-like 0.00022
Further Details:      
 
Domain Number 6 Region: 225-327
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.11e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0042
Further Details:      
 
Domain Number 7 Region: 553-630
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.43e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 291331.XOO3214
Sequence length 704
Comment (Xanthomonas oryzae KACC10331)
Sequence
MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKFDDTVLLVTAVAAKSAREGQDFFPLTV
DYQEKFYAGGRIPGGFFKREGRATEKETLISRLIDRPIRPLFPEDYKNEVQIIATVMSMN
PDIDGDIAALIGASAALSLAGTPFNGPIAAAKVGYKNGEYILNPTVTDLKDSQLELVVAG
TANAVLMVESEAELLSEEVMLGAVTFGHREMQKVINIINELAVEAGTKPSDWVAPAKNDG
MIAALKEAVGDQLASAFQVRDKLQRRDAISAIKKDVLGALAPRATIEGWAAGDLAKEFGE
LEYQTMRGSVLSTKVRIDGRALDTVRPISAKAGVLPRTHGSALFTRGETQAIVITTLGTA
RDGQVIDAVSGEYKENFLFHYNFPPYSVGECGRFGAPKRREIGHGRLAKRGVLAVMPSLE
EFPYTIRVVSEITESNGSSSMASVCGSSLALMDAGVPIKAPVAGIAMGLVKEGNDFVVLS
DILGDEDHLGDMDFKVAGTAEGVSALQMDIKIEGITEEIMKQALQQAKAGRLHILGEMAH
ALTTPRQELSDYAPRLLTIKIHPDKIREVIGKGGSTIQAITKETGTQIDIQDDGTIIIAS
VNAIAAQAAKSRIEQITSDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
EKVGDKLKEGDLVRVKVLEVDKQGRIRLSIKAVEEGEGVPASAE
Download sequence
Identical sequences A0A0U4VIH2 B2SVJ9 Q2P0X5 Q5GXV3
gi|188577676|ref|YP_001914605.1| 291331.XOO3214 342109.XOO_3047 360094.PXO_01307 WP_011259733.1.100287 WP_011259733.1.101918 WP_011259733.1.10801 WP_011259733.1.11746 WP_011259733.1.11992 WP_011259733.1.12016 WP_011259733.1.12038 WP_011259733.1.12284 WP_011259733.1.12532 WP_011259733.1.13943 WP_011259733.1.15093 WP_011259733.1.15664 WP_011259733.1.16001 WP_011259733.1.17939 WP_011259733.1.19029 WP_011259733.1.19407 WP_011259733.1.19779 WP_011259733.1.20356 WP_011259733.1.21407 WP_011259733.1.22155 WP_011259733.1.22948 WP_011259733.1.2575 WP_011259733.1.27990 WP_011259733.1.28412 WP_011259733.1.29999 WP_011259733.1.30088 WP_011259733.1.3010 WP_011259733.1.32656 WP_011259733.1.34187 WP_011259733.1.34656 WP_011259733.1.34831 WP_011259733.1.353 WP_011259733.1.35359 WP_011259733.1.38499 WP_011259733.1.39578 WP_011259733.1.40044 WP_011259733.1.40785 WP_011259733.1.41276 WP_011259733.1.42687 WP_011259733.1.42954 WP_011259733.1.43671 WP_011259733.1.44430 WP_011259733.1.45003 WP_011259733.1.4539 WP_011259733.1.46170 WP_011259733.1.47084 WP_011259733.1.47137 WP_011259733.1.48014 WP_011259733.1.48578 WP_011259733.1.49044 WP_011259733.1.49225 WP_011259733.1.49377 WP_011259733.1.50457 WP_011259733.1.50569 WP_011259733.1.51059 WP_011259733.1.52109 WP_011259733.1.53330 WP_011259733.1.537 WP_011259733.1.55471 WP_011259733.1.56638 WP_011259733.1.56661 WP_011259733.1.56997 WP_011259733.1.57225 WP_011259733.1.57350 WP_011259733.1.57652 WP_011259733.1.57864 WP_011259733.1.57935 WP_011259733.1.58736 WP_011259733.1.60363 WP_011259733.1.60953 WP_011259733.1.61025 WP_011259733.1.61774 WP_011259733.1.61876 WP_011259733.1.63306 WP_011259733.1.65775 WP_011259733.1.67359 WP_011259733.1.67821 WP_011259733.1.68588 WP_011259733.1.68727 WP_011259733.1.68760 WP_011259733.1.69729 WP_011259733.1.71791 WP_011259733.1.73657 WP_011259733.1.74787 WP_011259733.1.75518 WP_011259733.1.76491 WP_011259733.1.76573 WP_011259733.1.76801 WP_011259733.1.8070 WP_011259733.1.81518 WP_011259733.1.8269 WP_011259733.1.82912 WP_011259733.1.83077 WP_011259733.1.8313 WP_011259733.1.83277 WP_011259733.1.84104 WP_011259733.1.85262 WP_011259733.1.85266 WP_011259733.1.86486 WP_011259733.1.87020 WP_011259733.1.87238 WP_011259733.1.88561 WP_011259733.1.89095 WP_011259733.1.90241 WP_011259733.1.91866 WP_011259733.1.91997 WP_011259733.1.93038 WP_011259733.1.94099 WP_011259733.1.94601 WP_011259733.1.95101 WP_011259733.1.95975 WP_011259733.1.96729 WP_011259733.1.97155 WP_011259733.1.97395 WP_011259733.1.99258 gi|84624704|ref|YP_452076.1| gi|58582837|ref|YP_201853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]