SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 291331.XOO4422 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  291331.XOO4422
Domain Number 1 Region: 52-354
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.09e-84
Family alpha-L-arabinanase-like 0.00000395
Further Details:      
 
Domain Number 2 Region: 377-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-41
Family Beta-D-xylosidase C-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 291331.XOO4422
Sequence length 566
Comment (Xanthomonas oryzae KACC10331)
Sequence
MHALSTLCATLLIALAAPATAQAQASADVAFDWFDYRGDDAVFATSLPAGDYRNPILAGF
YPDPSITQVGNHYYLVNSTFTYFPAIPVFQSTDLVHWTQIGNVVERTDQLNYDGLEVSRG
MFAPTIRYHNGRYYVVGTSADNGGNFIASASNPAGPWSALSWLPGIDGIDLSLFFDTDGS
GYLLNNGPPEGTPQYEGHRAIWMQRFDLASNQPVGPRKVLLDRGVDPSSKPIWIEAPHLY
QRNGWYYLSCAEGGTLPDQQHRQVVLRSRHVWGPYASAPNNPILSQNALPAGRAHPVINA
GHADFVTTPDGQWWAVFLAARPYAGDRYNTGRETFLLPVQWRDDWPSILPAGAPIPTIAK
APALAAAASDQAPLSGNFTWHDDFDTSTLRRAWLFLRVPHQPLADLNTRTGWLTLHAGSQ
GLDGTGTPAFLARRQQHTRFTASTALAVPIQSGVSGGLAAFQNASAWYALGVRRDGDGLE
VFLDKRDGAQTSTLAHTHVALTTQVRLQISGDGGAYGFAFDADGRGWQVLRRDDDAGMLS
TAQAGGFVGTMIGPFAQLQPARPKED
Download sequence
Identical sequences A0A0U4VX16
gi|84625822|ref|YP_453194.1| 291331.XOO4422 342109.XOO_4165 WP_011260707.1.100287 WP_011260707.1.101918 WP_011260707.1.10801 WP_011260707.1.11746 WP_011260707.1.11992 WP_011260707.1.12016 WP_011260707.1.12038 WP_011260707.1.12284 WP_011260707.1.12532 WP_011260707.1.13943 WP_011260707.1.15093 WP_011260707.1.15664 WP_011260707.1.16001 WP_011260707.1.17939 WP_011260707.1.19029 WP_011260707.1.19407 WP_011260707.1.19779 WP_011260707.1.20356 WP_011260707.1.21407 WP_011260707.1.22155 WP_011260707.1.22948 WP_011260707.1.2575 WP_011260707.1.27990 WP_011260707.1.28412 WP_011260707.1.29999 WP_011260707.1.3010 WP_011260707.1.32656 WP_011260707.1.34187 WP_011260707.1.34656 WP_011260707.1.34831 WP_011260707.1.353 WP_011260707.1.35359 WP_011260707.1.38499 WP_011260707.1.39578 WP_011260707.1.40044 WP_011260707.1.40785 WP_011260707.1.41276 WP_011260707.1.42687 WP_011260707.1.42954 WP_011260707.1.43671 WP_011260707.1.44430 WP_011260707.1.45003 WP_011260707.1.4539 WP_011260707.1.46170 WP_011260707.1.47084 WP_011260707.1.48014 WP_011260707.1.48578 WP_011260707.1.49044 WP_011260707.1.49225 WP_011260707.1.49377 WP_011260707.1.50457 WP_011260707.1.50569 WP_011260707.1.51059 WP_011260707.1.53330 WP_011260707.1.537 WP_011260707.1.55471 WP_011260707.1.56638 WP_011260707.1.56661 WP_011260707.1.56997 WP_011260707.1.57225 WP_011260707.1.57350 WP_011260707.1.57652 WP_011260707.1.57864 WP_011260707.1.57935 WP_011260707.1.58736 WP_011260707.1.60363 WP_011260707.1.60953 WP_011260707.1.61774 WP_011260707.1.61876 WP_011260707.1.63306 WP_011260707.1.65775 WP_011260707.1.67359 WP_011260707.1.67821 WP_011260707.1.68588 WP_011260707.1.68727 WP_011260707.1.68760 WP_011260707.1.69729 WP_011260707.1.71791 WP_011260707.1.73657 WP_011260707.1.74787 WP_011260707.1.75518 WP_011260707.1.76491 WP_011260707.1.76573 WP_011260707.1.76801 WP_011260707.1.8070 WP_011260707.1.81518 WP_011260707.1.8269 WP_011260707.1.82912 WP_011260707.1.83077 WP_011260707.1.8313 WP_011260707.1.84104 WP_011260707.1.85262 WP_011260707.1.85266 WP_011260707.1.86486 WP_011260707.1.87020 WP_011260707.1.87238 WP_011260707.1.88561 WP_011260707.1.89095 WP_011260707.1.90241 WP_011260707.1.91866 WP_011260707.1.91997 WP_011260707.1.93038 WP_011260707.1.94601 WP_011260707.1.95101 WP_011260707.1.96729 WP_011260707.1.97155 WP_011260707.1.97395 WP_011260707.1.99258 gi|122879353|ref|YP_203061.6|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]