SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 292414.TM1040_0078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292414.TM1040_0078
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-48
Family Ribonuclease PH domain 1-like 0.0000267
Further Details:      
 
Domain Number 2 Region: 299-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-47
Family Ribonuclease PH domain 1-like 0.0000156
Further Details:      
 
Domain Number 3 Region: 145-242
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.51e-27
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 453-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.32e-26
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 610-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.01e-21
Family Cold shock DNA-binding domain-like 0.00042
Further Details:      
 
Domain Number 6 Region: 550-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.94e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 7 Region: 245-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000262
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 292414.TM1040_0078
Sequence length 711
Comment (Silicibacter TM1040)
Sequence
MFNVTTKTMQWGEETLTLETGKVARQADGTVIATLGETSVMANVTYAREQKPGQDFFPLT
VHYQEKYYAAGKIPGGFFKREARPTEKETLTARLIDRPIRPLFVPGFKNEVLVMCTVLSH
DLVNDPDIVAMIAASAALTISGVPFMGPIAGARVGYEDGEYILNPTVDDMQDLRLNPEQR
LDLVVAGTKDAVMMVESEAYELTEEEMLGAVTFAHEQIQPVIDLIVSLAEETAKEPFDFT
PPDYSDLYAAVKAAGEEKMRAAYAISDKQERVAAVGAAKEEIIASLTEEQQEDGNLGSAL
KKLESVVLRGDVVKNGRRIDGRALDQVRAIECQTGLLPRTHGSALFTRGETQGLVVTTLG
TGDDEQFIDALHGNFKSNFLLHYNFPPYSVGEVGRVGSPGRREIGHGKLAWRALQAVLPA
PTDFPYTIRVVSEITESNGSSSMASVCGGSLSMMDAGVPLKAPVAGVAMGLVLEEDGSYG
ILTDILGDEDHLGDMDFKVAGTEAGITSLQMDIKVAGITPEIMKNALAQAKAGRLHILGE
MAKSLTEASEFSQHAPRIETMQVPTDKIREVIGSGGKVIREIVEVSGAKVDINDDGVIKI
ASANGEAIQKAYDMIHAIVAEPEEGAVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENR
RLNHPSDVLKEGQEVKVKLLGFDDRGKVRLSMKVVDQETGEEIVAEKKEAE
Download sequence
Identical sequences Q1GKK5
WP_011537449.1.15988 gi|99079919|ref|YP_612073.1| 292414.TM1040_0078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]