SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 292459.STH3050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292459.STH3050
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.19e-50
Family Ribosomal protein S13 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 292459.STH3050
Sequence length 124
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MARIAGVDLPRDKRIEAALPYIYGIGWSLSREILKKTGIDPDTRVRDLTEEQVAKLREVI
DHEYKVEGDLQREVQMNIKRLIEIGCYRGLRHRRGLPVRGQRTKTNARTRKGPRRTVAGK
KKAK
Download sequence
Identical sequences A0A1Y2T6G6 Q67JW8
WP_011197165.1.72803 gi|51894185|ref|YP_076876.1| 292459.STH3050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]