SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 292459.STH326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  292459.STH326
Domain Number - Region: 227-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.038
Family Beta-D-xylosidase C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 292459.STH326
Sequence length 306
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MPNPVREIMRIQDRRAALGSVPGQQQTISERSGWSSQVTGLGVDGHPLLGGAIQLVAGAG
VTLTQDPVTGRIIISASGGGGGGVGYPRFDPDEPPAIPSQWDDEFNTSVLHQKWTPLAVH
GQGGFQAGEVISMLSCYGGHNDVNPMALLQSAPSGPWVMTAKVINAQQYLNGGGGDGSAC
VGLAVAPAADQGDAMDTWVIGHYSNANTYIRSEIWAKPISWGGSKGMFTFSSPSAYLRIV
WDGTRLSYWAAPDGLAWYQWVSPYAPNWTPGRIGITVRGAVGPSYVDWFRVTTSSSFTRT
TRHSWC
Download sequence
Identical sequences Q67SN2
292459.STH326 gi|51891464|ref|YP_074155.1| WP_011194460.1.72803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]