SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 292459.STH718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292459.STH718
Domain Number 1 Region: 202-504
Classification Level Classification E-value
Superfamily Subtilisin-like 1.7e-75
Family Subtilases 0.0000145
Further Details:      
 
Domain Number 2 Region: 1714-1809
Classification Level Classification E-value
Superfamily PKD domain 1.19e-17
Family PKD domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1178-1275
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.92e-16
Family Carboxypeptidase regulatory domain 0.016
Further Details:      
 
Domain Number 4 Region: 1816-1898
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000131
Family PKD domain 0.0013
Further Details:      
 
Domain Number 5 Region: 791-884
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000403
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 6 Region: 1107-1172
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000216
Family Carboxypeptidase regulatory domain 0.0077
Further Details:      
 
Domain Number 7 Region: 896-1048
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000601
Family MAM domain 0.042
Further Details:      
 
Domain Number 8 Region: 637-791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000222
Family MAM domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 292459.STH718
Sequence length 1899
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MRSAIRSRLLRSGLALLLAAAVPAQAPAAVGADMRPGPVQTEPRMPLVHSVTDESPARAL
AKIQSSVLEAFKSSEQVRYLVKLRVEADIMGAASAARELAPSPATAEVAARRAVVNSLQE
AAELSQAGLVSFLEKAQATGQVKSFQPFWIVNMVAVTSDQATMQKIAALPEVEAIYADEE
IHLIRSELVAVEEPAAVATGQPEWNIARIGAPGVWNQFDIDGTGVVVANLDTGVDGTHPA
LAAQYRGNGASDHSAFWLDVVNRRPQPYDDDGHGTHTMGTMVGRTPDGQVQIGVAPGAQW
IAVKILDETGSGYTSWILEGAQWLLNPGGDPANAPDVVNNSWGGGPGINEWFRSVVEAWR
AAGIVPIFAAGNSGPEPGTVAVPANYPESIAVGNIRKDDVLNGSSGRGPTPYGEIKPEVS
APGTLVRSALPGGLYGLMNGTSMAAPHVAGVAALLRQADASLTVDEIEEILTGTAEPLTS
DQYPSVPNNGYGYGVVDAHKAAASILGVADGRISGRLATEGEDFIGPTIRHTPVAQGFKR
APTVIAAEITDDVALTAVYLRFRQPGLTWWGIVDMTQVSGDHRGGTFIATIPGELSTADT
VEYYIEAVDYGNNHAYSGTRTQPHVVALIDGITPGYLEDFEQAVAGLITGWTTAGSPADQ
WQIGEPTTGPGAAYSGRNVAATNLHSNYANNAEAYLITPPIDLRDGPAALRFKHWYEFEN
NFDRGIVAATANYGETWDILASFTGSSGSYLEAVLDLSAYAGLSDIYVAFVLDSDGSVTR
QGWYIDDVEVYVDDEPPAAPANLTAQGTALGSVALTWDASEAVDLHHYTVYRSTSPGEGY
APIGSTTQPAYHDTTVEGGTTYYYVVTATDLFGNESAYSSEAAATPPVVDIRFRDDMEAG
PGEWTTAGTNDPWQWGVPTSGPGRAFSGEHLWATNLSGNYPNNANASLISPPIDLNGLAT
AALSFTHWYQLERNYDFGRVEITADGGETWTELAVYNSPSGSPPVGPETPIIDLTDYVGQ
TVQIRFRFTSDVSVTYPGWYVDDVMVVGTESGAARVDLSFSDPGDPITLKDEKHAQPASL
RMPLPDASVTRYRVESDEPAVIIQALPVLEGTVTALESGRVVRTNPVDGTYALLLPAGDY
TLLAEAYGYYPQTRRVTLGPGEDLSVNFLMEPIPRGFVTGTVTNAITGEPIRGARVQALE
DARVAPTFTDATGRFTLDLLVGSYTVRVSHPNHQMVEIPVEVLAGETTEIAVALNSFAGL
PGELAYDDGTAENARAIGAPNSGFAVRMSPEPGQTVMVTGARVRFWSSDWPVPGGNSFLV
AVYGSQPDGSPGRLLLGPIRVDNAVRGGWTEVDLRPYGLTVQGDFYVAVLQTDDYPYVPG
LAFDESSDQGRTWYVLDAREFEPFAAYGNAMIRALISTEIAPPVILSPTDGAFTNQTEVL
VEGTSAPNTTVTIFANGVPAAETTAGPEGAFAAVLTLDEGEYALTAVATDADGGSTSPSA
PVRIVVDLTAPELVIEHPADGAVQNHRLLTVTGQAVDPYLAGVDVNGTAAEVDDDGRFTA
EIIVREGENLITVTAVDRAGNATSAAVTMTVDTVPPELSNLHPDTDLTLRPGDTLTVSFD
SEPGLALAAFSIVPNLGGGSTHGDDATFGLEPGEIAMTETEPGHYEGTFTVPEGMSLPQA
FVRFRAMDAAGNTVRATAPGLLTIVPDAEPGEPGEPGEPGEPGEPGSPVAVIQGPTSVEV
NTNARWDAGQLSSDVPIVRYEWDMGDGTPIQPGRSITHRYGEPGTYTITVTATDRNGQTT
VVTLDVVVTAEETEGPKAVIEGPTMARRNHTVVYSGLKSTSRLPIVWYEWDMGDGTRSLQ
PTPVMIHQWAETGTYTVTLTVTDLEGNEDTVTLTVEVVR
Download sequence
Identical sequences Q67RJ0
gi|51891856|ref|YP_074547.1| WP_011194851.1.72803 292459.STH718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]