SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293614.A1C_03560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293614.A1C_03560
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-46
Family Ribonuclease PH domain 1-like 0.0000561
Further Details:      
 
Domain Number 2 Region: 298-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-42
Family Ribonuclease PH domain 1-like 0.000027
Further Details:      
 
Domain Number 3 Region: 451-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.22e-27
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 4 Region: 149-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-25
Family Ribonuclease PH domain 2-like 0.003
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 621-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-17
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.02e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293614.A1C_03560
Sequence length 747
Comment (Rickettsia akari Hartford)
Sequence
MFNEITKSVTWNGKVLELSTGKIARQADGAVTVKMGNSVLLCAAVVANKAKEGIGFFPLT
INYREMAYAAGKIPGGFFKREGKASDREVLVSRLIDRPIRPLFHPAFVNETHVTCTVLSY
DPETPVDILAIIGASAALSLSPAPYLEIVAASKVGLIDGEFVLNPTLELLKTSQLDLVVA
GTADSVMMVESEANLLSEEQMLEAVKFGFESFQPIIKIIKELAKEAKKPKFQMQDLYPAS
LKKEIEKLFVKEIKQAFAIKSKQERSTNLDLIHEKVLTHFVSDIENKKYSNYQIESALKS
IESDILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQLVDSLDGEYKERFMLDYIFPPYSVNEAMPMKAPSRREVGHGKLAWRAINPILPNKV
QFPYAIRVVAETTESNGSSSMATVCSSSLALMYAGVPIKAPVAGIAMGLVKEGKKFAVLS
DILGDEDYFGDMDFKVAGTSEGITALQMDIKISGVDFKIMKAALEQARLGRLHILDQMNK
IISKPNSKLGKNVPSTTTIKIDKDKIRDVIGPGGKVIKEICETSDAKIDISDDGTVSVYA
SDRDKLKVALDKIKAIAVEPEIGEIFNGTVMKVLDSGAFINYLGTKDGFVHISEIAEERI
ETVGSVLKQGDIVKVKLIGFDNKGKAKLTIKNADKDKSSNNPKQKNNVNNSKENSEPERR
DSSKKRAWNEDNNSDTTEVITERKYFN
Download sequence
Identical sequences A8GNL8
WP_012149625.1.98304 gi|157825781|ref|YP_001493501.1| 293614.A1C_03560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]