SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293614.A1C_05025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293614.A1C_05025
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily Translational machinery components 2.62e-44
Family Ribosomal protein L18 and S11 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293614.A1C_05025
Sequence length 118
Comment (Rickettsia akari Hartford)
Sequence
MRSAKLKFEKRRSRIRHKISKTSNRVRLSIFKSCRHIYAQIIDDSRSITIASASTLDEKI
TTLKKSYCNIDNAIKVGEAIAKKADSAGIKEVVFDRGGYKYHGVVKALADAAREKIKF
Download sequence
Identical sequences A8GPD4
WP_012149889.1.98304 gi|157826047|ref|YP_001493767.1| 293614.A1C_05025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]