SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_0245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  293826.Amet_0245
Domain Number - Region: 10-84
Classification Level Classification E-value
Superfamily Tropomyosin 0.000464
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_0245
Sequence length 92
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MDDKLFQLMEKMYSEMQEGFKKVNTKLDSVESRMSSVEFRMDKVEKTVLNMEDSHGKKLD
VLFDGYKQNSEKLDRIEEEVNKHEEVIIRKIK
Download sequence
Identical sequences A6TJW0
293826.Amet_0245 WP_011971387.1.32322 gi|150388088|ref|YP_001318137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]