SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_1773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_1773
Domain Number 1 Region: 43-268
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.46e-39
Family Legume lectins 0.0069
Further Details:      
 
Weak hits

Sequence:  293826.Amet_1773
Domain Number - Region: 288-361
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00479
Family Invasin/intimin cell-adhesion fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_1773
Sequence length 1505
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MKRILVKLLIMIMMVLMCKDIFIIGTVHAADLEPIAVMVELNNFDANNVGGDESSALLWK
RGDADTPSGSGILRVAPRARNKAGTVVRRNHIRLTDGFSTYFAIDIHSHGIDDGRSEPPG
ADGLAFIIYEADQPKIGKYGSGLGYSTITNSIAVEFDTWKNSGHGDLDNEHVAILVNGVV
SHHDQPEGSRVSYPKIRTDLIHAWVDYDDGIITATIGTSDVRSDDANETITRNVGDFLEG
KDVFIGFSASTGSAYSHHDVLKWYFKDSYVESGLETTQGTYSQAASTIDIELDNVINPVT
ATITLRDAVGNIMNNQNLDIYINDIKHNGSFNTGDNGVLNYSFLDNINDGEHVLRVIANG
GTSNFKRFATGENAVISTPEEYFYFDPGTGTITGYRDDGPKDVVIPSTIGGVLVTSIEYY
AFLFKQLTSVNIPEGVTSIGDYAFYYNQLTSVHIPEGITSIGSHGFDSNELTNVTILNKH
VDFGTSVFIWNQANLKIHGFDPSTTKNYAQANGHTFISLDQYTVTFKDHDGSLLKTEVVY
NGESATVPNNPTREGYTFAGWDKSFNNVTTDLEVIAQYDINQYTITFDSQGGSTVASQEV
DYNDLLVAPDLPVKVGYSFGGWYKEVELSNQWDFGLERVTENTIIYAKWNLGSDTAYKVE
HYQQDTVGAEYNLHETEDNLRGITGADVTALYKTYTGFTQNRSHDESVESGKILSDGSLV
LKLYYDRNMHTVNFESNGGTSVSDITGVRYGAIISSPITPTKDGSIFLRWYNGADLSDIW
NFTSDKVLTDTTLFAKWIDAESIRMTATPNNVAGSKNYSQMFTLHIHNDTVTGSVYASDM
SLGGAFNGLNIRTVDNKTSTTVTAEVYGNLDSEGVGTILLDGSKLTTSINPLIAEVTVTL
KGISYDGNGSTGGNIPTEDSGYAEGATVTVKENTGSLEKTGYTFIGWNTKADGSGSSYKP
NDTFSLSTTGSILYAQWKINRYTIIFNRNGGSAVNGQNIKHGESVAQPQEPTRTGYNFGG
WYKNSELNDVWDFYSDVTKEDTMLYAKWSRIPSGGSSGDSGNDTPKLEPDPIPEPIADFN
EIEVIINGETQKTGTETKIETEGKIEVKLTVDAEQMSKHIEEAIKVERDNNEVVIPVLNT
GDTVKVSLTGDIVKKLENNDFKISVKEENVTYRLSAKDFTIEKLAESMGVALDSLESIEV
EMSISKIDSEEIERLTANAKAVGHEIVFEPLQFEITARTTSNEGTVKEVKINRFKNYAER
IMEIPEELDPSRISTGVVFNSDGTYSHVPTEVFDKDNKWYAGINSLTNSTYSVIWNPTII
DNVNGHWSEKMVNDMASRLIILEVEDFMPDKAINRAEFATYIVRALGLYREGVQLSEEQE
LFIDIDNGHSAWKGITIANEWGIVNGYPDGTFRSDNIITREEAMTMYAKAMDIVKLAELD
KDRIFQYKDVSEVAPWAYASVNKTLSAGVFNGREKDMIAPKGTFTHAEAATAIRNLLVES
GLINK
Download sequence
Identical sequences A6TP27
293826.Amet_1773 gi|150389555|ref|YP_001319604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]