SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_2657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_2657
Domain Number 1 Region: 270-427
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.66e-29
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 163-259
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_2657
Sequence length 475
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MAKKIKDDADKNAETTKKEVLLEAKEEIHKLRNEFERESRERRNELQRVERRLMQKEESL
DKKSETLEQKDDRLSRKLRDLETKEEEIKLLYNKEVQKLEELSGLTSQQARELLLSDVEK
EVKYEAAMMVKDIETKAKDDADKKAREIITLAIQKCAADHVAETTVTVVQLPNDEMKGRI
IGREGRNIRTLETLTGIDLIIDDTPEAVILSGFDPIRREVARIALEKLIADGRIHPARIE
EMVEKAKKEVENILKEEGEQATFDTGVHGLHPELIRLLGRLKYRTSYGQNVLKHAIEVSH
LAGLMATELGADPKLAKRAGLLHDIGKAVDHEVEGTHIEIGMELLRKYKETKDVIHAMST
HHGDFEPETIEAILVTAADAISAARPGARRETLESYIKRLEKLEDIANNYDGVEKSFAIQ
AGREIRIIVKPEVYNDDEIYMFAREITKKIEADLEYPGQIKVNVIRETRAIEYAK
Download sequence
Identical sequences A6TRJ1
293826.Amet_2657 gi|150390419|ref|YP_001320468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]