SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_2667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_2667
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-49
Family Ribonuclease PH domain 1-like 0.0000122
Further Details:      
 
Domain Number 2 Region: 288-484
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-47
Family Ribonuclease PH domain 1-like 0.00000992
Further Details:      
 
Domain Number 3 Region: 136-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-29
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 450-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.06e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 552-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 609-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.48e-22
Family Cold shock DNA-binding domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_2667
Sequence length 704
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MIKQFQTELAGKTLHVEIGKYAEQASGSCMVRYGDTTVLVNATASKSPREGIDFFPLSVD
YEEKLYAVGKIPGGFIKREARPSEKAVLTSRLIDRPIRPLFPKGYRNEVQVIATVMSVDK
DYAPDIVAMIGSSIALSISDIPFGGPTGSVNVGLVNGEFVLNPTSDQRAISDIDLVVSGT
KDAIMMIESGANEVTEDQMLDALMFAHEEIKTIVAFIEEIVAEVGKPKQEVQLFAIDETL
DMEVRVFAKDKIVTAMKTFDKMERNERLDNVKKEILVHFSKQYENELKSIVEVINSIIKE
QFRYMITHDKVRPDERALDEIRPITSEVGILPRTHGTGLFTRGQTQVLTVATLGALGEVQ
ILDGLGEEESKRYMHHYNFPPYSVGEAKFLRGPGRREIGHGALAERALLPMVPSQDDFPY
AIRLVSEVLSSNGSSSQASVCGSTLALLDAGVPIKDMVAGIAMGLVKENDKIAILSDIQG
MEDALGDMDFKVAGTDKGITAIQMDIKIKGIHKDILKDALEQARVGRLHILDKMKKAIDK
PRPELSPFAPRVLKMKIHPDKIRDVIGSGGKTINRIIDETGVKIDIDNDGTIFIAAESQE
AVEKAIIIIENIIKDPEVGQNYTGKVIKIMNFGAFLEILPGKEGLLHVSNIAHERVNKVE
DVLEVGQEIEVKVMEIDQQGKINLSRKALLPKESKAENTKEEKA
Download sequence
Identical sequences A6TRK1
293826.Amet_2667 gi|150390429|ref|YP_001320478.1| WP_012063792.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]