SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_3317 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_3317
Domain Number 1 Region: 4-321
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.14e-103
Family alpha-L-arabinanase-like 0.000000000059
Further Details:      
 
Domain Number 2 Region: 327-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-71
Family Beta-D-xylosidase C-terminal domain-like 0.0000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_3317
Sequence length 541
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MITIHNPILTGFNPDPSICRVGEDYYIGVSTFEWFPGVGIYHSKDLKNWYLAARPLNRIS
QLNMVGNPDSGGIWAPQLSHSDGKYWLIYTDVKVVDGQWKDCHNYLVNCESIDGEWSDPI
YLNSSGFDPSLFHDEDGKKYLVNMLWDHRVGNHNFYGIVLQEYSVEKQKLVGKKDIIFKG
TDLKLTEAPHLYKMNGYYYLLTAEGGTKYDHAATIARSKDLRGPYEVHPKNPLLTSWAYP
RNPLQKSGHASIVTTHTDEWFLVHLTGRPLPKADQPLLDHRGYCPLGRETAIQRMEWEND
WPYVVGGNQPSLEIKGPNMEEVKWEKGHEEKDDFDTEILNHHFQTLRIPLGENILSLKHN
PGHLRLYGRESLTSKFTQAFVARRWQHFNFTAETKVAFNPESFQQSAGLVNYYNTQNWTS
IQISWQEDKGRILELMTCDNFTFAQPLRANEIVIPDHVDYVHLRVEVKTSTYEYGYSFDG
HNWITIPVEFYSYKLSDDYIQGGGFFTGAFVGMQCQDTSGANQYADFDYFIYKEGKEVME
R
Download sequence
Identical sequences A6TTC7
WP_012064410.1.32322 293826.Amet_3317 gi|150391055|ref|YP_001321104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]