SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_4239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_4239
Domain Number 1 Region: 117-203
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000475
Family N-acetyl transferase, NAT 0.0081
Further Details:      
 
Weak hits

Sequence:  293826.Amet_4239
Domain Number - Region: 69-129
Classification Level Classification E-value
Superfamily POZ domain 0.0011
Family Tetramerization domain of potassium channels 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_4239
Sequence length 214
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MNTINWVEWIGYIASTLILISLLMTSIVKLRLINLVGALIFAIYGFLIGAIPVAIANIAI
IIINIYYLTKLYAPGSTTEFFKVLAIDNNSPYFKYFLDFYETDILSYFPNHSMQFTHDMI
GFYVLRDLVPAGIFIGSRYDENTLLVELDFAIPEYRDLKIGKYLYEEHANYFLDLGYTRL
ISHVASEKHTSYLHKMGFMQSTEGDETIFVKHLL
Download sequence
Identical sequences A6TVV1
293826.Amet_4239 WP_012065267.1.32322 gi|150391929|ref|YP_001321978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]